MAARLLSLYGRCLSAAGAMRGLPAARVRWESSRAVIAPSGVEKKRQREPTMQWQEDPEPEDENVYAKNPDFHGYDSDPVVDVWNMRAVFFFGFSIVLVFGTTFVAYVPDYRMQEWARREAERLVKYREVNGLPIMESNYFDPSKIQLPEDD Ndufb11 NDUBB_MOUSE NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial Np15 NADH-ubiquinone oxidoreductase ESSS subunit Neuronal protein 15.6 151 Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). Complex I-ESSS